The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Thermus Thermophilus Putative Periplasmic Glutamate/Glutamine-Binding Protein. Acta Crystallogr.,Sect.D 60 1846 2004
    Site RSGI
    PDB Id 1us4 Target Id trt001000402.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14141, Molecular Weight 33345.69 Da.
    Residues 314 Isoelectric Point 9.25
    Sequence xrkpilaaltlaglglaqefitigsgsttgvyfpvatgiaklvndanvgiranarstggsvaninaina gefexalaqndiayyayqgccipafegkpvktiralaalypevvhvvarkdagirtvadlkgkrvvvgd vgsgteqnarqileaygltfddlgqairvsasqgiqlxqdkradalfytvglgasaiqqlalttpialv avdlnriqaiakkypfyvgfnipggtykgvdvttptvavqaxliaserlseetvykfxkavfgnleafk kihpnlerffglekavkglpiplhpgaerfykeagvlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.206
    Matthews' coefficent Rfactor 0.178
    Waters 235 Solvent Content

    Ligand Information
    Ligands GLU (1,2-ETHANEDIOL) x 1;EDO x 1


    Google Scholar output for 1us4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch