The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tt0497 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1ulr Target Id ttk003000497.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14385, Molecular Weight 9678.75 Da.
    Residues 88 Isoelectric Point 8.07
    Sequence mprlvalvkgrvqgvgyrafaqkkalelglsgyaenlpdgrvevvaegpkealelflhhlkqgprlarv eavevqwgeeaglkgfhvy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.21632
    Matthews' coefficent 1.47 Rfactor 0.18666
    Waters 151 Solvent Content 15.88

    Ligand Information


    Google Scholar output for 1ulr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch