The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the kinase-associated domain 1 of mouse microtubule-associated protein/microtubule affinity-regulating kinase 3. Protein Sci. 15 2534-2543 2006
    Site RSGI
    PDB Id 1ul7 Target Id mmt007019316.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13574, Molecular Weight 11054.22 Da.
    Residues 95 Isoelectric Point 8.94
    Sequence rftwsmkttssmdpsdmmreirkvldanncdyeqrerfllfcvhgdghaenlvqwemevcklprlslng vrfkrisgtsiafkniaskianelkl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1ul7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch