.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ujy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of SH3 domain in Rac/Cdc42 guanine nucleotide exchange factor(GEF) 6. To be Published
    Site RSGI
    PDB Id 1ujy Target Id hsk001000001.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12559, Molecular Weight 7362.87 Da.
    Residues 63 Isoelectric Point 6.53
    Sequence shqlivkarfnfkqtnedelsvckgdiiyvtrveeggwwegtlngrtgwfpsnyvreiksser
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ujy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch