The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The forkhead associated (FHA) domain like structure from mouse polynucleotide kinase 3'-phosphatase. To be Published
    Site RSGI
    PDB Id 1ujx Target Id mmt007020370.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13583, Molecular Weight 11320.46 Da.
    Residues 106 Isoelectric Point 9.51
    Sequence msqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtvavkqlgv npstvgvqelkpglsgslslgdvlylvnglypltlrw
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1ujx

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch