The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second fibronectin Type III domain of human KIAA1568 protein. To be Published
    Site RSGI
    PDB Id 1ujt Target Id hsk002001540.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12674, Molecular Weight 12342.48 Da.
    Residues 107 Isoelectric Point 9.40
    Sequence rqvqkelgdvlvrlhnpvvltpttvqvtwtvdrqpqfiqgyrvmyrqtsglqatsswqnldakvpters avlvnlkkgvtyeikvrpyfnefqgmdsesktvrttee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1ujt

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch