The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Oxyanion hole-stabilized stereospecific isomerization in ribose-5-phosphate isomerase (Rpi). J.Biol.Chem. 278 49183-49190 2003
    Site RSGI
    PDB Id 1uj5 Target Id ttk003000500.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14388, Molecular Weight 24065.59 Da.
    Residues 227 Isoelectric Point 5.06
    Sequence merplesykkeaahaaiayvqdgmvvglgtgstaryavlelarrlregelkgvvgvptsrateelakre giplvdlppegvdlaidgadeiapglalikgmggallrekivervakefiviadhtkkvpvlgrgpvpv eivpfgyratlkaiadlggepelrmdgdefyftdgghliadcrfgpigdplglhralleipgvvetglf vgmatralvagpfgveellp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 2.29 Rfactor 0.188
    Waters 275 Solvent Content 45.89

    Ligand Information
    Ligands 5RP (RIBULOSE-5-PHOSPHATE) x 1
    Metals CL (CHLORIDE) x 2


    Google Scholar output for 1uj5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch