The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Polyamine Aminopropyltransferase from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 1uir Target Id ttk003000339.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14336, Molecular Weight 36004.45 Da.
    Residues 314 Isoelectric Point 5.62
    Sequence mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterdeyiyhetlvh pamlthpepkrvlivgggegatlrevlkhptvekavmvdidgelvevakrhmpewhqgafddpravlvi ddaraylerteerydvviidltdpvgednparllytvefyrlvkahlnpggvmgmqagmillthhrvhp vvhrtvreafryvrsyknhipgfflnfgfllasdafdpaafsegviearirernlalrhltapyleamf vlpkdllealeketmvstdqnpfyvtpegearqapykg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 2.42 Rfactor 0.199
    Waters 373 Solvent Content 48.86

    Ligand Information


    Google Scholar output for 1uir

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch