.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uim

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of Threonine Synthase from Thermus thermophilus HB8: Conformational change, substrate recognition, and mechanism. J.BIOL.CHEM. 278 46035-46045 2003
    Site RSGI
    PDB Id 1uim Target Id ttk003000028.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14168, Molecular Weight 37007.61 Da.
    Residues 351 Isoelectric Point 8.73
    Sequence mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfkdrgmtlav skaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqslvhgarivqvegnfddal rltqklteafpvalvnsvnphrlegqktlafevvdelgdaphyhalpvgnagnitahwmgykayhalgk akrlprmlgfqaagaaplvlgrpverpetlatairignpaswqgavrakeesggvieavtdeeilfayr ylareegifcepasaaamagvfkllregrlepestvvltltghglkdpataervaelpppvparleava aaagll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.251
    Matthews' coefficent 2.32 Rfactor 0.21
    Waters 283 Solvent Content 46.52

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1uim

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch