.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ui0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Family 4 Uracil-DNA Glycosylase from Thermus thermophilus HB8. J.Mol.Biol. 333 515-526 2003
    Site RSGI
    PDB Id 1ui0 Target Id ttk003000721.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14417, Molecular Weight 22964.66 Da.
    Residues 205 Isoelectric Point 9.06
    Sequence mtlellqaqaqnctacrlmegrtrvvfgegnpdaklmivgegpgeeedktgrpfvgkagqllnrileaa gipreevyitnivkcrppqnraplpdeakictdkwllkqieliapqiivplgavaaefflgekvsitkv rgkwyewhgikvfpmfhpayllrnpsrapgspkhltwldiqevkraldalppkerrpvkavsqeplf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.201
    Matthews' coefficent 2.24 Rfactor 0.183
    Waters 202 Solvent Content 44.73

    Ligand Information
    Ligands SO4 (SULFATE) x 1;SF4 (IRON/SULFUR) x 1;URA (URACIL) x 2
    Metals

    Jmol

     
    Google Scholar output for 1ui0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch