.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uhz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of dsRNA binding domain in Staufen homolog 2. To be Published
    Site RSGI
    PDB Id 1uhz Target Id mmt007013925.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13548, Molecular Weight 8498.44 Da.
    Residues 76 Isoelectric Point 9.99
    Sequence pisrlaqiqqarkekepdyillsergmprrrefvmqvkvgnevatgtgpnkkiakknaaeamllqlgyk astslqd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1uhz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch