The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]. To be Published
    Site RSGI
    PDB Id 1uhc Target Id hsk002000986.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12626, Molecular Weight 7572.12 Da.
    Residues 66 Isoelectric Point 7.93
    Sequence seaegnqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsnyirkte
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1uhc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch