.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ugo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange. Structure 18 309-319 2010
    Site RSGI
    PDB Id 1ugo Target Id mmt007019936.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13577, Molecular Weight 9896.64 Da.
    Residues 86 Isoelectric Point 5.41
    Sequence mdmgnqhpsisrlqeiqrevkaiepqvvgfsglsddknykrleriltkqlfeidsvdtegkgdiqqark raaqeterllkeleqna
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ugo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch