.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ug7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208M17Rik similar to the protein FLJ12806. To be Published
    Site RSGI
    PDB Id 1ug7 Target Id mmk001006933.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13459, Molecular Weight 13307.36 Da.
    Residues 115 Isoelectric Point 5.43
    Sequence msevtrsllqrwgaslrrgadfdswgqlveaideyqilarhlqkeaqaqhnnsefteeqkktigkiatc lelrsaalqstqsqeefkledlkklepilkniltynkefpfdvqpi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ug7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch