The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Beta-Glucosidase at Atomic Resolution from Thermus Thermophilus Hb8. To be Published
    Site RSGI
    PDB Id 1ug6 Target Id ttk003000499.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14386, Molecular Weight 48635.44 Da.
    Residues 431 Isoelectric Point 5.78
    Sequence mtenaekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedialmqsl gvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlplaleerggwrsreta fafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglrnleaalraahhlllghglavealr aagarrvgivlnfapaygedpeavdvadryhnrffldpilgkgypespfrdpppvpilsrdlelvarpl dflgvnyyapvrvapgtgtlpvrylppegpatamgwevypeglyhllkrlgrevpwplyvtengaaypd lwtgeavvedpervayleahveaalrareegvdlrgyfvwslmdnfewafgytrrfglyyvdfpsqrri pkrsalwyreriaraqt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 0.99 Rfree 0.13
    Matthews' coefficent 2.50 Rfactor 0.121
    Waters 531 Solvent Content 50.37

    Ligand Information
    Ligands GOL (GLYCEROL) x 4


    Google Scholar output for 1ug6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch