The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Mouse Hypothetical Gene (2610100B20Rik) Product Homologous to Myb DNA-binding Domain. To be Published
    Site RSGI
    PDB Id 1ug2 Target Id mmk001002130.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13431, Molecular Weight 9053.83 Da.
    Residues 82 Isoelectric Point 6.34
    Sequence egalpkaseatvcannskvsspgekvvlwtreadrviltmcqeqgaqphtfsvisqqlgnktpvevshr frelmqlfhtace
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1ug2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch