The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of SH3 domain of Hypothetical protein BAA76854.1. To be Published
    Site RSGI
    PDB Id 1ug1 Target Id hsk002000986.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12625, Molecular Weight 8868.55 Da.
    Residues 79 Isoelectric Point 9.11
    Sequence asllaryppeklfqaernfnaaqdldvsllegdlvgvikkkdpmgsqnrwlidngvtkgfvyssflkpy nprrshsdas
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1ug1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch