The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RNP domain in Synaptojanin 2. To be Published
    Site RSGI
    PDB Id 1ufw Target Id hsk002000339.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12586, Molecular Weight 8934.78 Da.
    Residues 82 Isoelectric Point 4.87
    Sequence ssfqgpldatvvvnlqsptleeknefpedlrtelmqtlgsygtivlvrinqgqmlvtfadshsalsvld vdgmkvkgravki
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1ufw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch