.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ufo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT1662 from Thermus thermophilus HB8: a member of the alpha/beta hydrolase fold enzymes. Proteins 58 982-984 2005
    Site RSGI
    PDB Id 1ufo Target Id ttk003001662.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14767, Molecular Weight 26004.83 Da.
    Residues 238 Isoelectric Point 9.29
    Sequence mrvrterltlaglsvlaripeapkalllalhglqgskehilallpgyaergflllafdaprhgeregpp psskspryveevyrvalgfkeearrvaeeaerrfglplflaggslgafvahlllaegfrprgvlafigs gfpmklpqgqvvedpgvlalyqappatrgeayggvpllhlhgsrdlivplarmektlealrphypegrl arfveegaghtltplmarvglaflehwlear
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.60 Rfree 0.2071
    Matthews' coefficent 2.16 Rfactor 0.1699
    Waters 1835 Solvent Content 43.19

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ufo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch