The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SAND domain of the putative nuclear protein homolog (5830484A20Rik). To be Published
    Site RSGI
    PDB Id 1ufn Target Id mmk001007045.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13460, Molecular Weight 8951.79 Da.
    Residues 81 Isoelectric Point 8.89
    Sequence ndavdfsptlpvtcgkakgtlfqeklkqgaskkciqneagdwltvkeflneggratskdwkgvircnge tlrhleqkgllf
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1ufn

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch