The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT0836. To be Published
    Site RSGI
    PDB Id 1ufk Target Id ttk003000836.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14451, Molecular Weight 27629.31 Da.
    Residues 254 Isoelectric Point 5.08
    Sequence mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwleawrrdlkp alappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrpgdkvldlgtgsgvlaiaa eklggkalgvdidpmvlpqaeanakrngvrprflegsleaalpfgpfdllvanlyaelhaalapryrea lvpggralltgilkdraplvreamagagfrpleeaaegewvllaygr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.25
    Matthews' coefficent 2.62 Rfactor 0.232
    Waters 88 Solvent Content 52.72

    Ligand Information


    Google Scholar output for 1ufk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch