.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ufi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the human centromere protein B (CENP-B) dimerization domain at 1.65-A resolution. J.Biol.Chem. 278 51454-51461 2003
    Site RSGI
    PDB Id 1ufi Target Id trt001000147.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14087, Molecular Weight 7234.92 Da.
    Residues 64 Isoelectric Point 9.52
    Sequence gshmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrknharqagvrglghqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.30852
    Matthews' coefficent 2.27 Rfactor 0.2322
    Waters 147 Solvent Content 45.42

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ufi

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch