The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT1696 from Thermus thermophilus HB8. To be published
    Site RSGI
    PDB Id 1ufb Target Id ttk003001696.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14780, Molecular Weight 14108.13 Da.
    Residues 127 Isoelectric Point 5.25
    Sequence mnrardwleqarhnlrhaqgslglgdyawacfaaqqaaeaalkglhlargqvawghsildlladlpedv dvpedlveaakvldkyyiptrypdahpagpaarhytrleaeealdlaqkilafveekl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.228
    Matthews' coefficent 2.93 Rfactor 0.187
    Waters 280 Solvent Content 57.98

    Ligand Information


    Google Scholar output for 1ufb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch