.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uel

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Ubiquitin-interacting Motif of S5a Bound to the Ubiquitin-like Domain of HR23B. J.Biol.Chem. 279 4760-4767 2004
    Site RSGI
    PDB Id 1uel Target Id trt001000364.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14140, Molecular Weight 10729.87 Da.
    Residues 95 Isoelectric Point 7.02
    Sequence mqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddtalkeykideknf vvvmvtkpkavstpapatlehhhhhh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1uel

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch