The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the tRNA Processing Enzyme RNase PH from Aquifex aeolicus. J.Biol.Chem. 278 32397-32404 2003
    Site RSGI
    PDB Id 1uds Target Id trt001000260.4
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS14124, Molecular Weight 28285.85 Da.
    Residues 255 Isoelectric Point 5.31
    Sequence mrsdgrkedqlrpvsiqrdfleypegsclisfgktkvictasvienvpnwlkgkgqgwitaeysmlpra tqqrtiresvqgriggatheiqrmigramrtaveltkigertiwvdcdviqadggtrtaaitgafvava daiiklhkegiieetpikdfvaavsvgivndrilldlnfeedsaaqvdmnvvgtgsgrlsevhtmgeey sftkdelikmldlaqkginelielqkklyviqdgkwerselkevsstt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.255
    Matthews' coefficent 4.44 Rfactor 0.221
    Waters 95 Solvent Content 72.28

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;SO4 (SULFATE) x 2


    Google Scholar output for 1uds

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch