.
The Open Protein Structure Annotation Network
PDB Keyword
.

1udm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structures of actin depolymerizing factor homology domains. Protein Sci. 18 2384-2392 2009
    Site RSGI
    PDB Id 1udm Target Id mmk001003623.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13440, Molecular Weight 15943.07 Da.
    Residues 142 Isoelectric Point 5.28
    Sequence matkidkeacraaynlvrddgsaviwvtfrydgativpgdqgadyqhfiqqctddvrlfafvrfttgda mskrskfalitwigedvsglqraktgtdktlvkevvqnfakefvisdrkeleedfirselkkagganyd aqse
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1udm

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch