.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ucv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of Sterile alpha motif (SAM) domain of ephrin type-A receptor 8. To be Published
    Site RSGI
    PDB Id 1ucv Target Id hsk002001431.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12652, Molecular Weight 7481.30 Da.
    Residues 68 Isoelectric Point 10.40
    Sequence ltvgdwldsirmgryrdhfaaggysslgmvlrmnaqdvralgitlmghqkkilgsiqtmraqltstqg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ucv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch