.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uc8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Lysine Biosynthesis Enzyme, LysX, from Thermus thermophilus HB8. J.Mol.Biol. 332 729-740 2003
    Site RSGI
    PDB Id 1uc8 Target Id ttk003000837.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14452, Molecular Weight 30715.88 Da.
    Residues 280 Isoelectric Point 6.56
    Sequence mlailydrirpdermlferaealglpykkvyvpalpmvlgerpkelegvtvalercvsqsrglaaaryl talgipvvnrpevieacgdkwatsvalakaglpqpktalatdreealrlmeafgypvvlkpvigswgrl lakvtdraaaeallehkevlggfqhqlfyiqeyvekpgrdirvfvvgeraiaaiyrrsahwitntargg qaencplteevarlsvkaaeavgggvvavdlfesergllvnevnhtmefknsvhttgvdipgeilkyaw slas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2688
    Matthews' coefficent 2.29 Rfactor 0.2396
    Waters 113 Solvent Content 46.25

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1uc8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch