.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ub0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Analysis of Phosphomethylpyrimidine Kinase (ThiD) from Thermus Thermophilus Hb8. To be Published
    Site RSGI
    PDB Id 1ub0 Target Id ttk003000279.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14317, Molecular Weight 26778.47 Da.
    Residues 258 Isoelectric Point 9.04
    Sequence mrvaltiagsdsgggagvqadlkvffrfgvygtsaltlvtaqntlgvqrvhllppevvyaqiesvaqdf plhaaktgalgdaaiveavaeavrrfgvrplvvdpvmvaksgdpllakeaaaalkerlfpladlvtpnr leaeallgrpirtlkeaeeaakallalgpkavllkgghlegeeavdllatrggvlrfsaprvhtrnthg tgctlsaaiaallakgrplaeavaeakayltralktapslghghgpldhwa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.2316
    Matthews' coefficent 3.07 Rfactor 0.2066
    Waters 110 Solvent Content 59.64

    Ligand Information
    Ligands SO4 (SULFATE) x 1;DIO (1,4-DIETHYLENE) x 2;GOL (GLYCEROL) x 4
    Metals

    Jmol

     
    Google Scholar output for 1ub0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch