.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uay

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Type II 3-Hydroxyacyl-CoA Dehydrogenase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1uay Target Id ttk003000157.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14252, Molecular Weight 25596.10 Da.
    Residues 242 Isoelectric Point 6.78
    Sequence mersalvtggasglgraaalalkargyrvvvldlrregedliyvegdvtreedvrravaraqeeaplfa vvsaagvglaekilgkegphglesfrrvlevnllgtfnvlrlaawamrenppdaegqrgvivntasvaa fegqigqaayaaskggvvaltlpaarelagwgirvvtvapglfdtpllqglpekakaslaaqvpfpprl grpeeyaalvlhilenpmlngevvrldgalrmapr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.197
    Matthews' coefficent 1.79 Rfactor 0.181
    Waters 584 Solvent Content 30.69

    Ligand Information
    Ligands ADN (ADENOSINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1uay

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch