.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uar

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Rhodanese from Thermus thermophilus HB8. To be published
    Site RSGI
    PDB Id 1uar Target Id ttk003000342.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14337, Molecular Weight 32923.49 Da.
    Residues 285 Isoelectric Point 5.30
    Sequence mgyahpevlvstdwvqehledpkvrvlevdedillydtghipgaqkidwqrdfwdpvvrdfiseeefak lmerlgisndttvvlygdknnwwaayafwffkynghkdvrlmnggrqkwveegrplttevpsyppgrye vpyrdesirayrddvlehiikvkegkgalvdvrspqeyrgelthmpdypqegalraghipgaknipwak avnpdgtfksaeelralyeplgitkdkdivvycriaersshswfvlkyllgyphvknydgswtewgnlv gvpiakgee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.243
    Matthews' coefficent 2.00 Rfactor 0.206
    Waters 448 Solvent Content 38.05

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 1uar

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch