The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Pseudomonas aeruginosa Hfq protein. Acta Crystallogr.,Sect.D 61 141-146 2005
    Site RSGI
    PDB Id 1u1t Target Id my_001000020.2
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS13685, Molecular Weight 9103.06 Da.
    Residues 82 Isoelectric Point 9.52
    Sequence mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvpsrpvr lpsgdqpaepgna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.253
    Matthews' coefficent 2.57 Rfactor 0.205
    Waters 164 Solvent Content 51.70

    Ligand Information


    Google Scholar output for 1u1t

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch