The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Regulation through the secondary channel--structural framework for ppGpp-DksA synergism during transcription. Cell(Cambridge,Mass.) 118 297-309 2004
    Site RSGI
    PDB Id 1tjl Target Id eco001000138.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12263, Molecular Weight 17526.83 Da.
    Residues 151 Isoelectric Point 5.06
    Sequence mqegqnrktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdeaanf pdpvdraaqeeefslelrnrdrerklikkiektlkkvededfgycescgveigirrlearptadlcidc ktlaeirekqmag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.00 Rfree 0.268
    Matthews' coefficent 3.05 Rfactor 0.228
    Waters 1022 Solvent Content 58.00

    Ligand Information
    Metals ZN (ZINC) x 10


    Google Scholar output for 1tjl

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch