The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for transcription regulation by alarmone ppGpp. Cell(Cambridge,Mass.) 117 299-310 2004
    Site RSGI
    PDB Id 1smy Target Id trt001000270.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14130, Molecular Weight 35011.34 Da.
    Residues 315 Isoelectric Point 4.95
    Sequence mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhefstip gvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadveimnpdlhiatleeggrl nmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafqvedtrlgqrtdldkltlriwtdgsvtp lealnqaveilrehltyfsnpqaaavaapeeakepeappeqeeeldlpleelglstrvlhslkeegies vrallalnlkdlknipgigersleeikealekkgftlke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.266
    Matthews' coefficent 4.71 Rfactor 0.186
    Waters 9031 Solvent Content 73.87

    Ligand Information
    Ligands G4P (GUANOSINE-5',3'-TETRAPHOSPHATE) x 2
    Metals MG (MAGNESIUM) x 362;ZN (ZINC) x 4


    Google Scholar output for 1smy

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch