.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s0v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for substrate selection by t7 RNA polymerase. Cell(Cambridge,Mass.) 116 381-391 2004
    Site RSGI
    PDB Id 1s0v Target Id trt001000257.2
    Molecular Characteristics
    Source Bacteriophage t7
    Alias Ids TPS14117, Molecular Weight 98850.09 Da.
    Residues 883 Isoelectric Point 6.77
    Sequence mntiniakndfsdielaaipfntladhygerlareqlalehesyemgearfrkmferqlkagevadnaa akplittllpkmiarindwfeevkakrgkrptafqflqeikpeavayitikttlacltsadnttvqava saigraiedearfgrirdleakhfkknveeqlnkrvghvykkafmqvveadmlskgllggeawsswhke dsihvgvrciemliestgmvslhrqnagvvgqdsetielapeyaeaiatragalagispmfqpcvvppk pwtgitgggywangrrplalvrthskkalmryedvympevykainiaqntawkinkkvlavanvitkwk hcpvedipaiereelpmkpedidmnpealtawkraaaavyrkdkarksrrislefmleqankfanhkai wfpynmdwrgrvyavsmfnpqgndmtkglltlakgkpigkegyywlkihgancagvdkvpfperikfie enhenimacaksplentwwaeqdspfcflafcfeyagvqhhglsyncslplafdgscsgiqhfsamlrd evggravnllpsetvqdiygivakkvneilqadaingtdnevvtvtdentgeisekvklgtkalagqwl aygvtrsvtkrsvmtlaygskefgfrqqvledtiqpaidsgkglmftqpnqaagymakliwesvsvtvv aaveamnwlksaakllaaevkdkktgeilrkrcavhwvtpdgfpvwqeykkpiqtrlnlmflgqfrlqp tintnkdseidahkqesgiapnfvhsqdgshlrktvvwahekygiesfalihdsfgtipadaanlfkav retmvdtyescdvladfydqfadqlhesqldkmpalpakgnlnlrdilesdfafa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.20 Rfree 0.307
    Matthews' coefficent 3.28 Rfactor 0.255
    Waters 999 Solvent Content 62.22

    Ligand Information
    Ligands APC (DIPHOSPHOMETHYLPHOSPHONIC) x 4
    Metals MG (MAGNESIUM) x 8

    Jmol

     
    Google Scholar output for 1s0v

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch