The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Nuclear magnetic resonance and molecular dynamics studies on the interactions of the Ras-binding domain of Raf-1 with wild-type and mutant Ras proteins. J.Mol.Biol. 286 219-232 1999
    Site RSGI
    PDB Id 1rrb Target Id my_001000014.1
    Molecular Characteristics
    Source Rattus norvegicus
    Alias Ids TPS13677, Molecular Weight 11937.18 Da.
    Residues 107 Isoelectric Point 9.66
    Sequence asmtggqqmgrgsssktsntirvflpnkqrtvvnvrngmslhdclmkalkvrglqpeccavfrllqehk gkkarldwntdaasligeelqvdflklaaalehhhhhh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1rrb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch