.
The Open Protein Structure Annotation Network
PDB Keyword
.

1qqi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural comparison of the PhoB and OmpR DNA-binding/transactivation domains and the arrangement of PhoB molecules on the phosphate box. J.Mol.Biol. 295 1225-1236 2000
    Site RSGI
    PDB Id 1qqi Target Id trt001000190.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS14095, Molecular Weight 12154.33 Da.
    Residues 104 Isoelectric Point 6.29
    Sequence maveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwgtnvyvedrt vdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1qqi

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch