.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pms

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the pleckstrin homology domain of mouse Son-of-sevenless 1 (mSos1). J.Mol.Biol. 269 579-591 1997
    Site RSGI
    PDB Id 1pms Target Id my_001000016.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13679, Molecular Weight 15546.04 Da.
    Residues 136 Isoelectric Point 8.67
    Sequence gskqlaikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqprlp gassaeyrlkekffmrkvqindkddtseykhafeiilkdgnsvifsaksaeeknnwmaalislqyrs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1pms

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch