The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Thermus thermophilus HB8 H-protein of the glycine-cleavage system, resolved by a six-dimensional molecular-replacement method. Acta Crystallogr.,Sect.D 59 1610-1618 2003
    Site RSGI
    PDB Id 1onl Target Id ttk003000357.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14345, Molecular Weight 14082.03 Da.
    Residues 128 Isoelectric Point 4.10
    Sequence mdipkdrfytkthewalpegdtvlvgitdyaqdalgdvvyvelpevgrvvekgeavavvesvktasdiy apvageivevnlalektpelvnqdpygegwifrlkprdmgdldelldaggyqevlesea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.253
    Matthews' coefficent 2.00 Rfactor 0.186
    Waters 115 Solvent Content 37.94

    Ligand Information


    Google Scholar output for 1onl

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch