.
The Open Protein Structure Annotation Network
PDB Keyword
.

1odj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Purine Nucleoside Phosphorylase from Thermus Thermophilus. J.Mol.Biol. 337 1149 2004
    Site RSGI
    PDB Id 1odj Target Id ttk003000127.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14236, Molecular Weight 25413.76 Da.
    Residues 235 Isoelectric Point 6.13
    Sequence mspihvrahpgdvaervllpgdpgraewiaktflqnprryndhrglwgytglykgvpvsvqttgmgtps aaivveelvrlgarvlvrvgtagaassdlapgelivaqgavpldgttrqylegrpyapvpdpevfralw rraealgyphrvglvasedafyattpeearawarygvlafemeasalfllgrmrgvrtgailavsnrig dpelappevlqegvrrmvevaleavlev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.4 Rfree 0.286
    Matthews' coefficent 2.5 Rfactor 0.221
    Waters 258 Solvent Content 49.9

    Ligand Information
    Ligands SO4 (SULFATE) x 6;GMP (GUANOSINE) x 6
    Metals

    Jmol

     
    Google Scholar output for 1odj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch