.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ode

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Chorismate Mutase from Thermus Thermophilus. To be Published
    Site RSGI
    PDB Id 1ode Target Id ttk003000008.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14153, Molecular Weight 13709.05 Da.
    Residues 122 Isoelectric Point 5.60
    Sequence mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltfafpaeaarqigmhr vpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdlesaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.65 Rfree 0.239
    Matthews' coefficent 1.9 Rfactor 0.213
    Waters 332 Solvent Content 36.9

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ode

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch