.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nza

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of divalent cation tolerance protein (Cut A1) from thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 1nza Target Id ttk003001193.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14530, Molecular Weight 11621.88 Da.
    Residues 103 Isoelectric Point 5.02
    Sequence meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvkttthafpklke rvkalhpytvpeivalpiaegnreyldwlrentg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.246
    Matthews' coefficent 1.85 Rfactor 0.229
    Waters 84 Solvent Content 32.99

    Ligand Information
    Ligands SO4 (SULFATE) x 1;GOL (GLYCEROL) x 1
    Metals NA (SODIUM) x 2;CL (CHLORIDE) x 4

    Jmol

     
    Google Scholar output for 1nza

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch