.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l7z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a myristoylated CAP-23/NAP-22 N-terminal domain complexed with Ca2+/calmodulin. EMBO J. 23 712-718 2004
    Site RSGI
    PDB Id 1l7z Target Id my_001000039.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13715, Molecular Weight 16705.54 Da.
    Residues 148 Isoelectric Point 4.09
    Sequence adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtidfpefl tmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvny eefvqmmtak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.264
    Matthews' coefficent 2.33 Rfactor 0.239
    Waters 75 Solvent Content 47.30

    Ligand Information
    Ligands GLY-GLY-LYS-LEU-SER-LYS (MYRISTIC) x 1;MYR x 1
    Metals CA (CALCIUM) x 4

    Jmol

     
    Google Scholar output for 1l7z

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch