.
The Open Protein Structure Annotation Network
PDB Keyword
.

1koy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the DFF-C domain of DFF45/ICAD. A structural basis for the regulation of apoptotic DNA fragmentation. J.Mol.Biol. 321 317-327 2002
    Site RSGI
    PDB Id 1koy Target Id trt001000163.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14091, Molecular Weight 7000.59 Da.
    Residues 62 Isoelectric Point 5.00
    Sequence shiltalrekqapelslssqdlelvtkedpkalavalnwdikktetvqeacerelalrlqqt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1koy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch