.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kn0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the homologous-pairing domain from the human Rad52 recombinase in the undecameric form. Mol.Cell 10 359-371 2002
    Site RSGI
    PDB Id 1kn0 Target Id trt001000214.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14107, Molecular Weight 23399.26 Da.
    Residues 212 Isoelectric Point 8.16
    Sequence msgteeailggrdshpaagggsvlcfgqcqytaeeyqaiqkalrqrlgpeyissrmagggqkvcyiegh rvinlanemfgyngwahsitqqnvdfvdlnngkfyvgvcafvrvqlkdgsyhedvgygvseglkskals lekarkeavtdglkralrsfgnalgncildkdylrslnklprqlplevdltkakrqdlepsveearyns crpnm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 11
    Resolution (Å) 2.85 Rfree 0.2970000
    Matthews' coefficent 2.54 Rfactor 0.2310000
    Waters 82 Solvent Content 51.66

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1kn0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch