The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of argininosuccinate synthetase from Thermus thermophilus HB8. Structural basis for the catalytic action. J.Biol.Chem. 277 15890-15896 2002
    Site RSGI
    PDB Id 1kh2 Target Id ttk003000039.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14194, Molecular Weight 44813.73 Da.
    Residues 400 Isoelectric Point 5.65
    Sequence mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaialdlkeefvrdf vfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgndqvrfeltayalkpdikv iapwrewsfqgrkemiayaeahgipvpvtqekpysmdanllhisyeggvledpwaeppkgmfrmtqdpe eapdapeyveveffegdpvavngerlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggt ilyharravesltldrevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgn vyvvgrkapkslyrqdlvsfdeaggydqkdaegfikiqalrlrvralvereghga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.2410000
    Matthews' coefficent 4.54 Rfactor 0.2090000
    Waters 385 Solvent Content 72.90

    Ligand Information


    Google Scholar output for 1kh2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch