.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jzq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the recognition of isoleucyl-adenylate and an antibiotic, mupirocin, by isoleucyl-tRNA synthetase. J.Biol.Chem. 276 47387-47393 2001
    Site RSGI
    PDB Id 1jzq Target Id trt001000219.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14112, Molecular Weight 94555.18 Da.
    Residues 821 Isoelectric Point 6.18
    Sequence mfkevgepnfpkleeevlafwkrekifqksvenrkggprytvyegpptanglphvghaqarsykdlfpr yktmrgyyaprragwdthglpvelevekklglkskreieaygierfnqacresvftyekeweafteria ywvdledayatleptyiesiwwslknlfdrgllyrdhkvvpycprcgtplsshevalgykeiqdpsvyv rfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealileeglgrkllgegtqvl ktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqapafgaedletarvyglpllktvde egkllvepfkglyfreanrailrdlrgrgllfkeesylhsyphcwrcstplmyyateswfikntlfkde lirnnqeihwvpphikegrygewlknlvdwalsrnrywgtplpiwvcqacgkeeaigsfqelkaratkp lpepfdphrpyvdqvelacacggtmrrvpyvidvwydsgampfaslhypfeheevfresfpadfiaegi dqtrgwfnslhqlgvmlfgsiafknvichglildekgqkmskskgnvvdpwdiirkfgadalrwyiyvs appeadrrfgpnlvretvrdyfltlwnvysffvtyanldrpdlknppppekrpemdrwllarmqdliqr vtealeaydpttsaralrdfvvedlsqwyvrrnrrrfwknedaldreaayatlyealvlvatlaapftp flaevlwqnlvrsvrleakesvhladwpeadpaladealvaqmravlkvvdlaraaraksgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.00 Rfree 0.2720000
    Matthews' coefficent 4.10 Rfactor 0.2200000
    Waters Solvent Content 70.03

    Ligand Information
    Ligands ILA (N-[ISOLEUCINYL]-N'-[ADENOSYL]-DIAMINOSUFONE) x 1
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1jzq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch