The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of nitric oxide reductase (cytochrome P450nor) at atomic resolution. Acta Crystallogr.,Sect.D 58 81-89 2002
    Site RSGI
    PDB Id 1jfc Target Id my_001000027.2
    Molecular Characteristics
    Source Fusarium oxysporum
    Alias Ids TPS13697, Molecular Weight 44470.55 Da.
    Residues 404 Isoelectric Point 5.75
    Sequence tmasgapsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvrtrqg fpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddlleqmkqkgcangp vdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstareasaanqelldylailveqrlvep kddiisklcteqvkpgnidksdavqiaflllvagnatmvnmialgvatlaqhpdqlaqlkanpslapqf veelcryhtasalaikrtakedvmigdklvranegiiasnqsanrdeevfenpdefnmnrkwppqdplg fgfgdhrciaehlakaelttvfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.05 Rfree 0.1520000
    Matthews' coefficent 2.17 Rfactor 0.1170000
    Waters 892 Solvent Content 43.38

    Ligand Information


    Google Scholar output for 1jfc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch