The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Direct observation of photolysis-induced tertiary structural changes in hemoglobin. Proc.Natl.Acad.Sci.USA 100 7039-7044 2003
    Site RSGI
    PDB Id 1j3y Target Id my_001000029.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13702, Molecular Weight 15125.51 Da.
    Residues 141 Isoelectric Point 8.73
    Sequence vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgkkvadaltna vahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpavhasldkflasvstvlts kyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.55 Rfree 0.205
    Matthews' coefficent 2.39 Rfactor 0.162
    Waters 2272 Solvent Content 48.60

    Ligand Information


    Google Scholar output for 1j3y

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch