.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j3n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of 3-oxoacyl-(acyl-carrier protein) synthase II from Thermus thermophilus HB8. Acta Crystallogr.,Sect.F 64 358-366 2008
    Site RSGI
    PDB Id 1j3n Target Id ttk003000136.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14243, Molecular Weight 43207.12 Da.
    Residues 408 Isoelectric Point 6.15
    Sequence mrrvvvtglgaltpigvgqeafhkaqlagksgvrpitrfdasalpvriaaevdvdpgayldrkelrrld rfvqyaliaaqlaledaglkpedldpervgtlvgtgiggmetweaqsrvflergpnrispffipmmian masahiamrygftgpsstvvtacatgadalgsalrmiqlgeadlvlaggteaaitpmaigafavmrals trneepekasrpftlsrdgfvmgegagvlvleayehakkrgariyaelvgfgrsadahhitephpegkg aalamaralkdagiapeqvgyinahgtstpvgdraevlaikrvfgdhakrlmvsstksmighllgaaga veaiatvqalyhgvipptinledpdpeldldfvpepreakvdyalsnsfafgghnavlafkrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2576
    Matthews' coefficent 2.28 Rfactor 0.21
    Waters 462 Solvent Content 45.57

    Ligand Information
    Ligands CIT (CITRIC) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1j3n

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch